Lineage for d2i2ul1 (2i2u L:1-123)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399564Protein Ribosomal protein S12 [50302] (2 species)
  7. 2399565Species Escherichia coli [TaxId:562] [159087] (25 PDB entries)
    Uniprot P0A7S3 1-123
  8. 2399575Domain d2i2ul1: 2i2u L:1-123 [145473]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2ul1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2i2ul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2ul1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]}
atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
pka

SCOPe Domain Coordinates for d2i2ul1:

Click to download the PDB-style file with coordinates for d2i2ul1.
(The format of our PDB-style files is described here.)

Timeline for d2i2ul1: