Lineage for d2i2uj1 (2i2u J:5-102)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862993Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
  5. 862994Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 862995Protein Ribosomal protein S10 [55001] (2 species)
  7. 862996Species Escherichia coli [TaxId:562] [160319] (24 PDB entries)
    Uniprot P0A7R5 5-102
  8. 863012Domain d2i2uj1: 2i2u J:5-102 [145471]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1
    automatically matched to 2AVY J:5-102
    complexed with mg

Details for d2i2uj1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (J:) 30S ribosomal protein S10

SCOP Domain Sequences for d2i2uj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2uj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]}
ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
yeirthlrlvdiveptektvdalmrldlaagvdvqisl

SCOP Domain Coordinates for d2i2uj1:

Click to download the PDB-style file with coordinates for d2i2uj1.
(The format of our PDB-style files is described here.)

Timeline for d2i2uj1: