Lineage for d2i2ue1 (2i2u E:78-158)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1636637Family d.14.1.1: Translational machinery components [54212] (4 proteins)
  6. 1636680Protein Ribosomal protein S5, C-terminal domain [54215] (3 species)
  7. 1636683Species Escherichia coli [TaxId:562] [159906] (24 PDB entries)
    Uniprot P0A7W1 78-158
  8. 1636699Domain d2i2ue1: 2i2u E:78-158 [145466]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2uc2, d2i2ud1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1
    automatically matched to 2AVY E:78-158
    protein/RNA complex; complexed with mg

Details for d2i2ue1

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (E:) 30S ribosomal protein S5

SCOPe Domain Sequences for d2i2ue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2ue1 d.14.1.1 (E:78-158) Ribosomal protein S5, C-terminal domain {Escherichia coli [TaxId: 562]}
gtlqhpvkgvhtgsrvfmqpasegtgiiaggamravlevagvhnvlakaygstnpinvvr
atidglenmnspemvaakrgk

SCOPe Domain Coordinates for d2i2ue1:

Click to download the PDB-style file with coordinates for d2i2ue1.
(The format of our PDB-style files is described here.)

Timeline for d2i2ue1: