![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
![]() | Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) ![]() automatically mapped to Pfam PF00189 |
![]() | Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
![]() | Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160263] (24 PDB entries) Uniprot P0A7V3 106-206 |
![]() | Domain d2i2uc2: 2i2u C:106-206 [145464] Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2i2u (more details), 3.22 Å
SCOPe Domain Sequences for d2i2uc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2uc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]} rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte wyregrvplhtlradidyntseahttygvigvkvwifkgei
Timeline for d2i2uc2: