Lineage for d2i2uc2 (2i2u C:106-206)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904893Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 1904894Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 1904895Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 1904896Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 1904897Species Escherichia coli [TaxId:562] [160263] (24 PDB entries)
    Uniprot P0A7V3 106-206
  8. 1904907Domain d2i2uc2: 2i2u C:106-206 [145464]
    Other proteins in same PDB: d2i2ub1, d2i2uc1, d2i2ud1, d2i2ue1, d2i2ue2, d2i2uf1, d2i2ug1, d2i2uh1, d2i2ui1, d2i2uj1, d2i2uk1, d2i2ul1, d2i2um1, d2i2un1, d2i2uo1, d2i2up1, d2i2uq1, d2i2ur1, d2i2us1, d2i2ut1, d2i2uu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2uc2

PDB Entry: 2i2u (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2i2uc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2uc2 d.53.1.1 (C:106-206) Ribosomal protein S3 C-terminal domain {Escherichia coli [TaxId: 562]}
rkpeldaklvadsitsqlerrvmfrramkravqnamrlgakgikvevsgrlggaeiarte
wyregrvplhtlradidyntseahttygvigvkvwifkgei

SCOPe Domain Coordinates for d2i2uc2:

Click to download the PDB-style file with coordinates for d2i2uc2.
(The format of our PDB-style files is described here.)

Timeline for d2i2uc2: