![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily) alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta; |
![]() | Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) ![]() some topological similarity to ribosomal protein L22 automatically mapped to Pfam PF01196 |
![]() | Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein) |
![]() | Protein Prokaryotic ribosomal protein L17 [64265] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [160270] (27 PDB entries) Uniprot P02416 1-127 |
![]() | Domain d2i2tn1: 2i2t N:1-120 [145454] Other proteins in same PDB: d2i2t01, d2i2t11, d2i2t21, d2i2t31, d2i2t41, d2i2tc1, d2i2tc2, d2i2td1, d2i2te1, d2i2tf1, d2i2tg1, d2i2tg2, d2i2th1, d2i2th2, d2i2ti1, d2i2ti2, d2i2tj1, d2i2tk1, d2i2tl1, d2i2tm1, d2i2to1, d2i2tp1, d2i2tq1, d2i2tr1, d2i2ts1, d2i2tt1, d2i2tu1, d2i2tv1, d2i2tw1, d2i2tx1, d2i2ty1, d2i2tz1 protein/RNA complex; complexed with mg, zn protein/RNA complex; complexed with mg, zn |
PDB Entry: 2i2t (more details), 3.22 Å
SCOPe Domain Sequences for d2i2tn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2tn1 d.188.1.1 (N:1-120) Prokaryotic ribosomal protein L17 {Escherichia coli [TaxId: 562]} mrhrksgrqlnrnsshrqamfrnmagslvrheiikttlpkakelrrvveplitlaktdsv anrrlafartrdneivaklfnelgprfasraggytrilkcgfragdnapmayielvdrse
Timeline for d2i2tn1:
![]() Domains from other chains: (mouse over for more information) d2i2t01, d2i2t11, d2i2t21, d2i2t31, d2i2t41, d2i2tc1, d2i2tc2, d2i2td1, d2i2te1, d2i2tf1, d2i2tg1, d2i2tg2, d2i2th1, d2i2th2, d2i2ti1, d2i2ti2, d2i2tj1, d2i2tk1, d2i2tl1, d2i2tm1, d2i2to1, d2i2tp1, d2i2tq1, d2i2tr1, d2i2ts1, d2i2tt1, d2i2tu1, d2i2tv1, d2i2tw1, d2i2tx1, d2i2ty1, d2i2tz1 |