Lineage for d2i2ti2 (2i2t I:1-72)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946680Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2946681Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2946682Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2946686Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2946692Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 2946697Domain d2i2ti2: 2i2t I:1-72 [145451]
    Other proteins in same PDB: d2i2t01, d2i2t11, d2i2t21, d2i2t31, d2i2t41, d2i2tc1, d2i2tc2, d2i2td1, d2i2te1, d2i2tf1, d2i2tg1, d2i2tg2, d2i2th1, d2i2th2, d2i2ti1, d2i2tj1, d2i2tk1, d2i2tl1, d2i2tm1, d2i2tn1, d2i2to1, d2i2tp1, d2i2tq1, d2i2tr1, d2i2ts1, d2i2tt1, d2i2tu1, d2i2tv1, d2i2tw1, d2i2tx1, d2i2ty1, d2i2tz1
    protein/RNA complex; complexed with mg, zn
    protein/RNA complex; complexed with mg, zn

Details for d2i2ti2

PDB Entry: 2i2t (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2i2ti2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2ti2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

SCOPe Domain Coordinates for d2i2ti2:

Click to download the PDB-style file with coordinates for d2i2ti2.
(The format of our PDB-style files is described here.)

Timeline for d2i2ti2: