Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) |
Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
Protein Ribosomal protein L4 [52168] (5 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
Species Escherichia coli [TaxId:562] [159477] (29 PDB entries) Uniprot P60723 1-201 |
Domain d2i2te1: 2i2t E:1-201 [145444] Other proteins in same PDB: d2i2t01, d2i2t11, d2i2t21, d2i2t31, d2i2t41, d2i2tc1, d2i2tc2, d2i2td1, d2i2tf1, d2i2tg1, d2i2tg2, d2i2th1, d2i2th2, d2i2ti1, d2i2ti2, d2i2tj1, d2i2tk1, d2i2tl1, d2i2tm1, d2i2tn1, d2i2to1, d2i2tp1, d2i2tq1, d2i2tr1, d2i2ts1, d2i2tt1, d2i2tu1, d2i2tv1, d2i2tw1, d2i2tx1, d2i2ty1, d2i2tz1 automatically matched to 2AW4 E:1-201 complexed with mg, zn |
PDB Entry: 2i2t (more details), 3.22 Å
SCOP Domain Sequences for d2i2te1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2te1 c.22.1.1 (E:1-201) Ribosomal protein L4 {Escherichia coli [TaxId: 562]} melvlkdaqsaltvsettfgrdfnealvhqvvvayaagarqgtraqktraevtgsgkkpw rqkgtgrarsgsikspiwrsggvtfaarpqdhsqkvnkkmyrgalksilselvrqdrliv vekfsveapktkllaqklkdmaledvliitgeldenlflaarnlhkvdvrdatgidpvsl iafdkvvmtadavkqveemla
Timeline for d2i2te1:
View in 3D Domains from other chains: (mouse over for more information) d2i2t01, d2i2t11, d2i2t21, d2i2t31, d2i2t41, d2i2tc1, d2i2tc2, d2i2td1, d2i2tf1, d2i2tg1, d2i2tg2, d2i2th1, d2i2th2, d2i2ti1, d2i2ti2, d2i2tj1, d2i2tk1, d2i2tl1, d2i2tm1, d2i2tn1, d2i2to1, d2i2tp1, d2i2tq1, d2i2tr1, d2i2ts1, d2i2tt1, d2i2tu1, d2i2tv1, d2i2tw1, d2i2tx1, d2i2ty1, d2i2tz1 |