Class j: Peptides [58231] (121 folds) |
Fold j.122: Ribosomal protein S21p [161307] (1 superfamily) non-globular, mainly alpha-helical |
Superfamily j.122.1: Ribosomal protein S21p [161308] (1 family) |
Family j.122.1.1: Ribosomal protein S21p [161309] (1 protein) Pfam PF01165 |
Protein Ribosomal protein S21, RpsU [161310] (1 species) |
Species Escherichia coli [TaxId:562] [161311] (24 PDB entries) Uniprot P68679 4-54 |
Domain d2i2pu1: 2i2p U:3-53 [145440] Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2ps1, d2i2pt1 automatically matched to 2AVY U:3-53 complexed with mg |
PDB Entry: 2i2p (more details), 3.22 Å
SCOP Domain Sequences for d2i2pu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2pu1 j.122.1.1 (U:3-53) Ribosomal protein S21, RpsU {Escherichia coli [TaxId: 562]} ikvrenepfdvalrrfkrscekagvlaevrrrefyekptterkrakasavk
Timeline for d2i2pu1: