Lineage for d2i2ps1 (2i2p S:2-80)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023082Fold d.28: Ribosomal protein S19 [54569] (1 superfamily)
    alpha-beta-X-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 123
  4. 1023083Superfamily d.28.1: Ribosomal protein S19 [54570] (1 family) (S)
  5. 1023084Family d.28.1.1: Ribosomal protein S19 [54571] (1 protein)
  6. 1023085Protein Ribosomal protein S19 [54572] (2 species)
  7. 1023086Species Escherichia coli [TaxId:562] [160144] (26 PDB entries)
    Uniprot P0A7U3 2-80
  8. 1023101Domain d2i2ps1: 2i2p S:2-80 [145438]
    Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2pt1, d2i2pu1
    automatically matched to 2AVY S:2-80
    protein/RNA complex; complexed with mg

Details for d2i2ps1

PDB Entry: 2i2p (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (S:) 30S ribosomal protein S19

SCOPe Domain Sequences for d2i2ps1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2ps1 d.28.1.1 (S:2-80) Ribosomal protein S19 {Escherichia coli [TaxId: 562]}
rslkkgpfidlhllkkvekavesgdkkplrtwsrrstifpnmigltiavhngrqhvpvfv
tdemvghklgefaptrtyr

SCOPe Domain Coordinates for d2i2ps1:

Click to download the PDB-style file with coordinates for d2i2ps1.
(The format of our PDB-style files is described here.)

Timeline for d2i2ps1: