SCOPe 2.05: Domain d2i2pr1: 2i2p R:19-73

Lineage for d2i2pr1 (2i2p R:19-73)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family)

5. Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)

6. Protein Ribosomal protein S18 [46913] (2 species)

7. Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
   Uniprot P0A7T7 19-73

8. Domain d2i2pr1: 2i2p R:19-73 [145437]
   Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pq1, d2i2ps1, d2i2pt1, d2i2pu1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2i2pr1

PDB Entry: 2i2p, 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2i2pr1:

Sequence; same for both SEQRES and ATOM records:

>d2i2pr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

Timeline for d2i2pr1:

• d2i2pr1 first appeared in SCOP 1.75
  
• d2i2pr1 appears in SCOPe 2.04
  
• d2i2pr1 appears in SCOPe 2.06
  
• d2i2pr1 appears in the current release, SCOPe 2.08