![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) ![]() |
![]() | Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
![]() | Protein Ribosomal protein S15 [47065] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [158383] (10 PDB entries) Uniprot Q8X9M2 2-89 |
![]() | Domain d2i2po1: 2i2p O:1-88 [145434] Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2ps1, d2i2pt1, d2i2pu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2i2p (more details), 3.22 Å
SCOPe Domain Sequences for d2i2po1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2po1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]} slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs qrrklldylkrkdvarytrlierlglrr
Timeline for d2i2po1: