Lineage for d2i2pm1 (2i2p M:1-114)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752104Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1752105Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1752106Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 1752107Protein Ribosomal protein S13 [46948] (2 species)
  7. 1752108Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
    Uniprot P0A7S9 1-114
  8. 1752115Domain d2i2pm1: 2i2p M:1-114 [145432]
    Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2ps1, d2i2pt1, d2i2pu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2pm1

PDB Entry: 2i2p (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2i2pm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2pm1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp

SCOPe Domain Coordinates for d2i2pm1:

Click to download the PDB-style file with coordinates for d2i2pm1.
(The format of our PDB-style files is described here.)

Timeline for d2i2pm1: