Lineage for d2i2pl1 (2i2p L:1-123)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789332Protein Ribosomal protein S12 [50302] (2 species)
  7. 1789333Species Escherichia coli [TaxId:562] [159087] (25 PDB entries)
    Uniprot P0A7S3 1-123
  8. 1789340Domain d2i2pl1: 2i2p L:1-123 [145431]
    Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pm1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2ps1, d2i2pt1, d2i2pu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2pl1

PDB Entry: 2i2p (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (L:) 30S ribosomal protein S12

SCOPe Domain Sequences for d2i2pl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2pl1 b.40.4.5 (L:1-123) Ribosomal protein S12 {Escherichia coli [TaxId: 562]}
atvnqlvrkprarkvaksnvpaleacpqkrgvctrvytttpkkpnsalrkvcrvrltngf
evtsyiggeghnlqehsvilirggrvkdlpgvryhtvrgaldcsgvkdrkqarskygvkr
pka

SCOPe Domain Coordinates for d2i2pl1:

Click to download the PDB-style file with coordinates for d2i2pl1.
(The format of our PDB-style files is described here.)

Timeline for d2i2pl1: