![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() |
![]() | Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
![]() | Protein Ribosomal protein S10 [55001] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160319] (24 PDB entries) Uniprot P0A7R5 5-102 |
![]() | Domain d2i2pj1: 2i2p J:5-102 [145429] Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2ps1, d2i2pt1, d2i2pu1 automatically matched to 2AVY J:5-102 complexed with mg |
PDB Entry: 2i2p (more details), 3.22 Å
SCOP Domain Sequences for d2i2pj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2pj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]} ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq yeirthlrlvdiveptektvdalmrldlaagvdvqisl
Timeline for d2i2pj1: