SCOP 1.75: Domain d2i2pe2: 2i2p E:9-77

Lineage for d2i2pe2 (2i2p E:9-77)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
   alpha-beta(3)-alpha; 2 layers: alpha/beta

4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families)

5. Family d.50.1.2: Ribosomal S5 protein, N-terminal domain [54778] (1 protein)

6. Protein Ribosomal S5 protein, N-terminal domain [54779] (3 species)
   lacks the N-terminal helix

7. Species Escherichia coli [TaxId:562] [160202] (24 PDB entries)
   Uniprot P0A7W1 9-77

8. Domain d2i2pe2: 2i2p E:9-77 [145425]
   Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2ps1, d2i2pt1, d2i2pu1
   automatically matched to 2AVY E:9-77
   complexed with mg

Details for d2i2pe2

PDB Entry: 2i2p, 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.

PDB Compounds: (E:) 30S ribosomal protein S5

SCOP Domain Sequences for d2i2pe2:

Sequence; same for both SEQRES and ATOM records:

>d2i2pe2 d.50.1.2 (E:9-77) Ribosomal S5 protein, N-terminal domain {Escherichia coli [TaxId: 562]}
elqekliavnrvsktvkggrifsftaltvvgdgngrvgfgygkarevpaaiqkamekarr
nminvalnn

Timeline for d2i2pe2:

• d2i2pe2 is new in SCOP 1.75
  
• d2i2pe2 appears in SCOPe 2.01
  
• d2i2pe2 appears in the current release, SCOPe 2.08