Lineage for d2i2pc1 (2i2p C:1-105)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190902Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2190960Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2190961Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 2190977Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)
  7. 2190980Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
    Uniprot P0A7V3 1-105
  8. 2190987Domain d2i2pc1: 2i2p C:1-105 [145421]
    Other proteins in same PDB: d2i2pb1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2ph1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2ps1, d2i2pt1, d2i2pu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2i2pc1

PDB Entry: 2i2p (more details), 3.22 Å

PDB Description: Crystal Structure of Ribosome with messenger RNA and the Anticodon stem-loop of P-site tRNA. This file contains the 30s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2i2pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i2pc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

SCOPe Domain Coordinates for d2i2pc1:

Click to download the PDB-style file with coordinates for d2i2pc1.
(The format of our PDB-style files is described here.)

Timeline for d2i2pc1: