SCOPe 2.01: Domain d2i26p1: 2i26 P:2-113

Lineage for d2i26p1 (2i26 P:2-113)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Novel antigen receptor (against lysozyme) [110042] (1 species)

7. Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (3 PDB entries)
   Uniprot Q8AXI4 # fragment

8. Domain d2i26p1: 2i26 P:2-113 [145419]
   Other proteins in same PDB: d2i26l1, d2i26m1, d2i26o_, d2i26q1
   automatically matched to 2I26 N:2-113
   complexed with so4

Details for d2i26p1

PDB Entry: 2i26, 2.5 Å

PDB Description: Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain in complex with lysozyme

PDB Compounds: (P:) New Antigen Receptor Ancestral

SCOPe Domain Sequences for d2i26p1:

Sequence; same for both SEQRES and ATOM records:

>d2i26p1 b.1.1.1 (P:2-113) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvna

Timeline for d2i26p1:

• d2i26p1 first appeared in SCOP 1.75
  
• d2i26p1 appears in SCOPe 2.02
  
• d2i26p1 appears in the current release, SCOPe 2.08, called d2i26p2