Lineage for d2i26p1 (2i26 P:2-113)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783696Protein Novel antigen receptor (against lysozyme) [110042] (1 species)
  7. 783697Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [110043] (4 PDB entries)
    Uniprot Q8AXI4 # fragment
  8. 783705Domain d2i26p1: 2i26 P:2-113 [145419]
    Other proteins in same PDB: d2i26l1, d2i26m1, d2i26q1
    automatically matched to 2I26 N:2-113
    complexed with so4

Details for d2i26p1

PDB Entry: 2i26 (more details), 2.5 Å

PDB Description: Crystal structure analysis of the nurse shark new antigen receptor ancestral variable domain in complex with lysozyme
PDB Compounds: (P:) New Antigen Receptor Ancestral

SCOP Domain Sequences for d2i26p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i26p1 b.1.1.1 (P:2-113) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
rvdqtpqtitketgesltincvlrdsncalsstywyrkksgstneesiskggryvetvns
gsksfslrindltvedsgtyrckpesrygsydaecaalndqygggtvvtvna

SCOP Domain Coordinates for d2i26p1:

Click to download the PDB-style file with coordinates for d2i26p1.
(The format of our PDB-style files is described here.)

Timeline for d2i26p1: