Lineage for d2hyec3 (2hye C:403-675)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885662Fold e.40: Cullin homology domain [75631] (1 superfamily)
    3 domains: (1) 4-helical bundle; (2) alpha+beta; (3) "winged helix"-like
  4. 885663Superfamily e.40.1: Cullin homology domain [75632] (1 family) (S)
  5. 885664Family e.40.1.1: Cullin homology domain [75633] (2 proteins)
  6. 885670Protein Cullin-4A [160968] (1 species)
  7. 885671Species Human (Homo sapiens) [TaxId:9606] [160969] (1 PDB entry)
    Uniprot Q13619 402-675
  8. 885672Domain d2hyec3: 2hye C:403-675 [145416]
    Other proteins in same PDB: d2hyec1, d2hyec2, d2hyed1
    complexed with zn

Details for d2hyec3

PDB Entry: 2hye (more details), 3.1 Å

PDB Description: crystal structure of the ddb1-cul4a-rbx1-sv5v complex
PDB Compounds: (C:) Cullin-4A

SCOP Domain Sequences for d2hyec3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyec3 e.40.1.1 (C:403-675) Cullin-4A {Human (Homo sapiens) [TaxId: 9606]}
nkpaeliakhvdsklragnkeatdeelertldkimilfrfihgkdvfeafykkdlakrll
vgksasvdaeksmlsklkhecgaaftsklegmfkdmelskdimvhfkqhmqnqsdsgpid
ltvniltmgywptytpmevhltpemiklqevfkafylgkhsgrklqwqttlghavlkaef
kegkkefqvslfqtlvllmfnegdgfsfeeikmatgiedselrrtlqslacgkarvliks
pkgkevedgdkfifngefkhklfrikinqiqmk

SCOP Domain Coordinates for d2hyec3:

Click to download the PDB-style file with coordinates for d2hyec3.
(The format of our PDB-style files is described here.)

Timeline for d2hyec3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2hyed1