Lineage for d2hvyd1 (2hvy D:4-124)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914576Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 1914577Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 1914594Protein Ribosomal protein L7ae [55319] (7 species)
  7. 1914671Species Pyrococcus furiosus [TaxId:2261] [160502] (1 PDB entry)
    Uniprot Q8U160 3-123
  8. 1914672Domain d2hvyd1: 2hvy D:4-124 [145413]
    Other proteins in same PDB: d2hvya1, d2hvya2, d2hvyb1, d2hvyc1
    protein/RNA complex; complexed with atp, zn

Details for d2hvyd1

PDB Entry: 2hvy (more details), 2.3 Å

PDB Description: Crystal structure of an H/ACA box RNP from Pyrococcus furiosus
PDB Compounds: (D:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d2hvyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvyd1 d.79.3.1 (D:4-124) Ribosomal protein L7ae {Pyrococcus furiosus [TaxId: 2261]}
kpsyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeei
vahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvkelm
k

SCOPe Domain Coordinates for d2hvyd1:

Click to download the PDB-style file with coordinates for d2hvyd1.
(The format of our PDB-style files is described here.)

Timeline for d2hvyd1: