SCOPe 2.01: Domain d2hvyd1: 2hvy D:4-124

Lineage for d2hvyd1 (2hvy D:4-124)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Pyrococcus furiosus [TaxId:2261] [160502] (1 PDB entry)
   Uniprot Q8U160 3-123

8. Domain d2hvyd1: 2hvy D:4-124 [145413]
   Other proteins in same PDB: d2hvya1, d2hvya2, d2hvyb1, d2hvyc1
   protein/RNA complex; complexed with atp, zn

Details for d2hvyd1

PDB Entry: 2hvy, 2.3 Å

PDB Description: crystal structure of an h/aca box rnp from pyrococcus furiosus

PDB Compounds: (D:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d2hvyd1:

Sequence; same for both SEQRES and ATOM records:

>d2hvyd1 d.79.3.1 (D:4-124) Ribosomal protein L7ae {Pyrococcus furiosus [TaxId: 2261]}
kpsyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeei
vahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvkelm
k

Timeline for d2hvyd1:

• d2hvyd1 first appeared in SCOP 1.75
  
• d2hvyd1 appears in SCOPe 2.02
  
• d2hvyd1 appears in the current release, SCOPe 2.08