Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) |
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
Protein Ribosomal protein L7ae [55319] (7 species) |
Species Pyrococcus furiosus [TaxId:2261] [160502] (1 PDB entry) Uniprot Q8U160 3-123 |
Domain d2hvyd1: 2hvy D:4-124 [145413] Other proteins in same PDB: d2hvya1, d2hvya2, d2hvyb1, d2hvyc1 protein/RNA complex; complexed with atp, zn |
PDB Entry: 2hvy (more details), 2.3 Å
SCOPe Domain Sequences for d2hvyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hvyd1 d.79.3.1 (D:4-124) Ribosomal protein L7ae {Pyrococcus furiosus [TaxId: 2261]} kpsyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiaedvdpeei vahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeiamkvkelm k
Timeline for d2hvyd1:
View in 3D Domains from other chains: (mouse over for more information) d2hvya1, d2hvya2, d2hvyb1, d2hvyc1 |