Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family) automatically mapped to Pfam PF04135 |
Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins) Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204) |
Protein Ribosome biogenesis protein Nop10 [144214] (2 species) |
Species Pyrococcus furiosus [TaxId:2261] [144215] (10 PDB entries) Uniprot Q8U1R4 4-55 |
Domain d2hvyc1: 2hvy C:3-55 [145412] Other proteins in same PDB: d2hvya1, d2hvya2, d2hvyb1, d2hvyd1 protein/RNA complex; complexed with atp, zn |
PDB Entry: 2hvy (more details), 2.3 Å
SCOPe Domain Sequences for d2hvyc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hvyc1 g.41.16.1 (C:3-55) Ribosome biogenesis protein Nop10 {Pyrococcus furiosus [TaxId: 2261]} frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi
Timeline for d2hvyc1:
View in 3D Domains from other chains: (mouse over for more information) d2hvya1, d2hvya2, d2hvyb1, d2hvyd1 |