SCOPe 2.08: Domain d2hvyc1: 2hvy C:3-55

Lineage for d2hvyc1 (2hvy C:3-55)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.16: Nop10-like SnoRNP [144210] (1 family)
   automatically mapped to Pfam PF04135

5. Family g.41.16.1: Nucleolar RNA-binding protein Nop10-like [144211] (3 proteins)
   Pfam PF04135; contains N-terminal zinc-finger domain similar to the insert finger of the Initiation factor eIF2 gamma subunit (75204)

6. Protein Ribosome biogenesis protein Nop10 [144214] (2 species)

7. Species Pyrococcus furiosus [TaxId:2261] [144215] (10 PDB entries)
   Uniprot Q8U1R4 4-55

8. Domain d2hvyc1: 2hvy C:3-55 [145412]
   Other proteins in same PDB: d2hvya1, d2hvya2, d2hvyb1, d2hvyd1
   protein/RNA complex; complexed with atp, zn

Details for d2hvyc1

PDB Entry: 2hvy, 2.3 Å

PDB Description: crystal structure of an h/aca box rnp from pyrococcus furiosus

PDB Compounds: (C:) Ribosome biogenesis protein Nop10

SCOPe Domain Sequences for d2hvyc1:

Sequence; same for both SEQRES and ATOM records:

>d2hvyc1 g.41.16.1 (C:3-55) Ribosome biogenesis protein Nop10 {Pyrococcus furiosus [TaxId: 2261]}
frirkcpkcgrytlkevcpvcgektkvahpprfspedpygeyrrrwkrevlgi

Timeline for d2hvyc1:

• d2hvyc1 first appeared in SCOP 1.75
  
• d2hvyc1 appears in SCOPe 2.07