Lineage for d2hvyb1 (2hvy B:1-74)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801236Superfamily b.43.3: Translation proteins [50447] (6 families) (S)
  5. 801512Family b.43.3.5: Gar1-like SnoRNP [141341] (1 protein)
    stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907
  6. 801513Protein Gar1 homolog PF1791 [141342] (1 species)
  7. 801514Species Archaeon Pyrococcus furiosus [TaxId:2261] [141343] (3 PDB entries)
    Uniprot Q8U029 1-73
  8. 801517Domain d2hvyb1: 2hvy B:1-74 [145411]
    Other proteins in same PDB: d2hvya1, d2hvya2, d2hvyc1, d2hvyd1
    complexed with atp, zn; mutant

Details for d2hvyb1

PDB Entry: 2hvy (more details), 2.3 Å

PDB Description: crystal structure of an h/aca box rnp from pyrococcus furiosus
PDB Compounds: (B:) Small nucleolar rnp similar to gar1

SCOP Domain Sequences for d2hvyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvyb1 b.43.3.5 (B:1-74) Gar1 homolog PF1791 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
npeiyvgevlyvde

SCOP Domain Coordinates for d2hvyb1:

Click to download the PDB-style file with coordinates for d2hvyb1.
(The format of our PDB-style files is described here.)

Timeline for d2hvyb1: