![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.5: Gar1-like SnoRNP [141341] (2 proteins) stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907 automatically mapped to Pfam PF04410 |
![]() | Protein Gar1 homolog PF1791 [141342] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [141343] (4 PDB entries) Uniprot Q8U029 1-73 |
![]() | Domain d2hvyb1: 2hvy B:1-74 [145411] Other proteins in same PDB: d2hvya1, d2hvya2, d2hvyc1, d2hvyd1 protein/RNA complex; complexed with atp, zn |
PDB Entry: 2hvy (more details), 2.3 Å
SCOPe Domain Sequences for d2hvyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hvyb1 b.43.3.5 (B:1-74) Gar1 homolog PF1791 {Pyrococcus furiosus [TaxId: 2261]} mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs npeiyvgevlyvde
Timeline for d2hvyb1:
![]() Domains from other chains: (mouse over for more information) d2hvya1, d2hvya2, d2hvyc1, d2hvyd1 |