SCOPe 2.08: Domain d2hvyb1: 2hvy B:1-74

Lineage for d2hvyb1 (2hvy B:1-74)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.5: Gar1-like SnoRNP [141341] (2 proteins)
   stand alone proteins, which are similar structurally but not sequentially to the elongation factor domains, unlike PF0907
   automatically mapped to Pfam PF04410

6. Protein Gar1 homolog PF1791 [141342] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [141343] (4 PDB entries)
   Uniprot Q8U029 1-73

8. Domain d2hvyb1: 2hvy B:1-74 [145411]
   Other proteins in same PDB: d2hvya1, d2hvya2, d2hvyc1, d2hvyd1
   protein/RNA complex; complexed with atp, zn

Details for d2hvyb1

PDB Entry: 2hvy, 2.3 Å

PDB Description: crystal structure of an h/aca box rnp from pyrococcus furiosus

PDB Compounds: (B:) Small nucleolar rnp similar to gar1

SCOPe Domain Sequences for d2hvyb1:

Sequence; same for both SEQRES and ATOM records:

>d2hvyb1 b.43.3.5 (B:1-74) Gar1 homolog PF1791 {Pyrococcus furiosus [TaxId: 2261]}
mkrlgkvlhyakqgflivrtnwvpslndrvvdkrlqfvgivkdvfgpvkmpyvaikpkvs
npeiyvgevlyvde

Timeline for d2hvyb1:

• d2hvyb1 first appeared in SCOP 1.75
  
• d2hvyb1 appears in SCOPe 2.07