Lineage for d2huea1 (2hue A:2-164)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1300372Superfamily b.1.22: ASF1-like [101546] (1 family) (S)
    contains extra C-terminal strand
    automatically mapped to Pfam PF04729
  5. 1300373Family b.1.22.1: ASF1-like [101547] (2 proteins)
  6. 1300374Protein Anti-silencing protein 1, ASF1 [101548] (3 species)
  7. 1300375Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101549] (3 PDB entries)
  8. 1300377Domain d2huea1: 2hue A:2-164 [145410]
    Other proteins in same PDB: d2hueb_, d2huec_
    complexed with gol, so4, zn

Details for d2huea1

PDB Entry: 2hue (more details), 1.7 Å

PDB Description: structure of the h3-h4 chaperone asf1 bound to histones h3 and h4
PDB Compounds: (A:) Anti-silencing protein 1

SCOPe Domain Sequences for d2huea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2huea1 b.1.22.1 (A:2-164) Anti-silencing protein 1, ASF1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwdnenegdlypp

SCOPe Domain Coordinates for d2huea1:

Click to download the PDB-style file with coordinates for d2huea1.
(The format of our PDB-style files is described here.)

Timeline for d2huea1: