Lineage for d2htkb1 (2htk B:18-458)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024422Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 3024423Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 3024424Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 3024425Protein Clc chloride channel [69913] (2 species)
  7. 3024426Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 3024438Domain d2htkb1: 2htk B:18-458 [145407]
    Other proteins in same PDB: d2htkd1, d2htkd2, d2htkf1, d2htkf2
    automatically matched to 2HTK A:17-460
    complexed with br; mutant

Details for d2htkb1

PDB Entry: 2htk (more details), 3.41 Å

PDB Description: structure of the escherichia coli clc chloride channel y445a mutant and fab complex
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2htkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2htkb1 f.20.1.1 (B:18-458) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplasailartlakqea

SCOPe Domain Coordinates for d2htkb1:

Click to download the PDB-style file with coordinates for d2htkb1.
(The format of our PDB-style files is described here.)

Timeline for d2htkb1: