Lineage for d2htka1 (2htk A:17-460)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253242Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2253243Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2253244Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2253245Protein Clc chloride channel [69913] (2 species)
  7. 2253246Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 2253259Domain d2htka1: 2htk A:17-460 [145406]
    Other proteins in same PDB: d2htkd1, d2htkd2, d2htkf1, d2htkf2
    complexed with br; mutant

Details for d2htka1

PDB Entry: 2htk (more details), 3.41 Å

PDB Description: Structure of the Escherichia coli ClC chloride channel Y445A mutant and Fab complex
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2htka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2htka1 f.20.1.1 (A:17-460) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplasailartlakqeaeq

SCOPe Domain Coordinates for d2htka1:

Click to download the PDB-style file with coordinates for d2htka1.
(The format of our PDB-style files is described here.)

Timeline for d2htka1: