Lineage for d2ht4a1 (2ht4 A:17-460)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. Protein Clc chloride channel [69913] (2 species)
  7. Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. Domain d2ht4a1: 2ht4 A:17-460 [145404]
    Other proteins in same PDB: d2ht4d1, d2ht4d2, d2ht4f1, d2ht4f2
    complexed with br; mutant

Details for d2ht4a1

PDB Entry: 2ht4 (more details), 3.2 Å

PDB Description: Structure of the Escherichia coli ClC chloride channel Y445W mutant and Fab complex
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2ht4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ht4a1 f.20.1.1 (A:17-460) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplwsailartlakqeaeq

SCOPe Domain Coordinates for d2ht4a1 are not available.

Timeline for d2ht4a1:

Domains from other chains:
(mouse over for more information)
d2ht4b1, d2ht4d1, d2ht4d2, d2ht4f1, d2ht4f2