Lineage for d2ht2b1 (2ht2 B:18-458)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 886952Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 886953Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 886954Family f.20.1.1: Clc chloride channel [69912] (1 protein)
    duplication: consist of two similar structural parts
  6. 886955Protein Clc chloride channel [69913] (2 species)
  7. 886956Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 886990Domain d2ht2b1: 2ht2 B:18-458 [145401]
    Other proteins in same PDB: d2ht2d1, d2ht2d2, d2ht2f1, d2ht2f2
    automatically matched to 2HT2 A:17-460
    complexed with br; mutant

Details for d2ht2b1

PDB Entry: 2ht2 (more details), 3.32 Å

PDB Description: structure of the escherichia coli clc chloride channel y445h mutant and fab complex
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOP Domain Sequences for d2ht2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ht2b1 f.20.1.1 (B:18-458) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplhsailartlakqea

SCOP Domain Coordinates for d2ht2b1:

Click to download the PDB-style file with coordinates for d2ht2b1.
(The format of our PDB-style files is described here.)

Timeline for d2ht2b1: