Lineage for d2ht2a1 (2ht2 A:17-460)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629845Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2629846Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2629847Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2629848Protein Clc chloride channel [69913] (2 species)
  7. 2629849Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 2629872Domain d2ht2a1: 2ht2 A:17-460 [145400]
    Other proteins in same PDB: d2ht2d1, d2ht2d2, d2ht2f1, d2ht2f2
    complexed with br; mutant

Details for d2ht2a1

PDB Entry: 2ht2 (more details), 3.32 Å

PDB Description: structure of the escherichia coli clc chloride channel y445h mutant and fab complex
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2ht2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ht2a1 f.20.1.1 (A:17-460) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplhsailartlakqeaeq

SCOPe Domain Coordinates for d2ht2a1:

Click to download the PDB-style file with coordinates for d2ht2a1.
(The format of our PDB-style files is described here.)

Timeline for d2ht2a1: