SCOPe 2.06: Domain d2hlfa1: 2hlf A:17-460

Lineage for d2hlfa1 (2hlf A:17-460)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.20: Clc chloride channel [81341] (1 superfamily)
   core: 18 transmembrane helices

4. Superfamily f.20.1: Clc chloride channel [81340] (1 family)

5. Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
   duplication: consist of two similar structural parts

6. Protein Clc chloride channel [69913] (2 species)

7. Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)

8. Domain d2hlfa1: 2hlf A:17-460 [145398]
   Other proteins in same PDB: d2hlfd1, d2hlfd2, d2hlff1, d2hlff2
   complexed with br; mutant

Details for d2hlfa1

PDB Entry: 2hlf, 3.3 Å

PDB Description: structure of the escherichis coli clc chloride channel y445e mutant and fab complex

PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2hlfa1:

Sequence; same for both SEQRES and ATOM records:

>d2hlfa1 f.20.1.1 (A:17-460) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplesailartlakqeaeq

Timeline for d2hlfa1:

• d2hlfa1 first appeared in SCOP 1.75
  
• d2hlfa1 appears in SCOPe 2.05
  
• d2hlfa1 appears in SCOPe 2.07
  
• d2hlfa1 appears in the current release, SCOPe 2.08