Lineage for d2hlfa1 (2hlf A:17-460)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456404Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 1456405Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 1456406Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 1456407Protein Clc chloride channel [69913] (2 species)
  7. 1456408Species Escherichia coli [TaxId:562] [69914] (18 PDB entries)
  8. 1456431Domain d2hlfa1: 2hlf A:17-460 [145398]
    Other proteins in same PDB: d2hlfd1, d2hlfd2, d2hlff1, d2hlff2
    complexed with br; mutant

Details for d2hlfa1

PDB Entry: 2hlf (more details), 3.3 Å

PDB Description: structure of the escherichis coli clc chloride channel y445e mutant and fab complex
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d2hlfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hlfa1 f.20.1.1 (A:17-460) Clc chloride channel {Escherichia coli [TaxId: 562]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplesailartlakqeaeq

SCOPe Domain Coordinates for d2hlfa1:

Click to download the PDB-style file with coordinates for d2hlfa1.
(The format of our PDB-style files is described here.)

Timeline for d2hlfa1: