Lineage for d2hlea1 (2hle A:17-196)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 792860Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (2 proteins)
  6. 792861Protein Ephrin type-B receptor 4 [158957] (1 species)
  7. 792862Species Human (Homo sapiens) [TaxId:9606] [158958] (2 PDB entries)
    Uniprot P54760 17-196
  8. 792864Domain d2hlea1: 2hle A:17-196 [145397]
    Other proteins in same PDB: d2hleb1

Details for d2hlea1

PDB Entry: 2hle (more details), 2.05 Å

PDB Description: structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.
PDB Compounds: (A:) Ephrin type-B receptor 4

SCOP Domain Sequences for d2hlea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hlea1 b.18.1.4 (A:17-196) Ephrin type-B receptor 4 {Human (Homo sapiens) [TaxId: 9606]}
eetllntkletadlkwvtfpqvdgqweelsgldeeqhsvrtyevcdvqrapgqahwlrtg
wvprrgavhvyatlrftmleclslpragrscketftvfyyesdadtataltpawmenpyi
kvdtvaaehltrkrpgaeatgkvnvktlrlgplskagfylafqdqgacmallslhlfykk

SCOP Domain Coordinates for d2hlea1:

Click to download the PDB-style file with coordinates for d2hlea1.
(The format of our PDB-style files is described here.)

Timeline for d2hlea1: