SCOPe 2.08: Domain d2hlea1: 2hle A:11-196

Lineage for d2hlea1 (2hle A:11-196)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
   automatically mapped to Pfam PF01404

6. Protein Ephrin type-B receptor 4 [158957] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158958] (2 PDB entries)
   Uniprot P54760 17-196

8. Domain d2hlea1: 2hle A:11-196 [145397]
   Other proteins in same PDB: d2hlea2, d2hleb_

Details for d2hlea1

PDB Entry: 2hle, 2.05 Å

PDB Description: structural and biophysical characterization of the ephb4-ephrinb2 protein protein interaction and receptor specificity.

PDB Compounds: (A:) Ephrin type-B receptor 4

SCOPe Domain Sequences for d2hlea1:

Sequence; same for both SEQRES and ATOM records:

>d2hlea1 b.18.1.4 (A:11-196) Ephrin type-B receptor 4 {Human (Homo sapiens) [TaxId: 9606]}
hhhhhheetllntkletadlkwvtfpqvdgqweelsgldeeqhsvrtyevcdvqrapgqa
hwlrtgwvprrgavhvyatlrftmleclslpragrscketftvfyyesdadtataltpaw
menpyikvdtvaaehltrkrpgaeatgkvnvktlrlgplskagfylafqdqgacmallsl
hlfykk

Timeline for d2hlea1:

• d2hlea1 first appeared in SCOP 1.75
  
• d2hlea1 appears in SCOPe 2.07