Lineage for d2hj9d_ (2hj9 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2211190Superfamily d.110.6: Sensory domain-like [103190] (3 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2211236Family d.110.6.3: LuxQ-periplasmic domain-like [160679] (1 protein)
    Pfam PF09308; two-domain arrangement similar to the YkuI C-terminal domain-like
  6. 2211237Protein Autoinducer 2 sensor kinase/phosphatase LuxQ [160680] (3 species)
  7. 2211242Species Vibrio harveyi [TaxId:669] [160681] (3 PDB entries)
    Uniprot P54302 51-271! Uniprot P54302 52-270
  8. 2211246Domain d2hj9d_: 2hj9 D: [145396]
    Other proteins in same PDB: d2hj9a_, d2hj9b_
    automated match to d1zhhb1
    complexed with ai2

Details for d2hj9d_

PDB Entry: 2hj9 (more details), 2.34 Å

PDB Description: Crystal structure of the Autoinducer-2-bound form of Vibrio harveyi LuxP complexed with the periplasmic domain of LuxQ
PDB Compounds: (D:) Autoinducer 2 sensor kinase/phosphatase luxQ

SCOPe Domain Sequences for d2hj9d_:

Sequence, based on SEQRES records: (download)

>d2hj9d_ d.110.6.3 (D:) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
alihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpshtpefrfl
tdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrrvpildp
stgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepynvadvlq
rkssdkrldkllvietpivvnavttelclltvq

Sequence, based on observed residues (ATOM records): (download)

>d2hj9d_ d.110.6.3 (D:) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
alihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpshtpefrfl
tdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrrvpildp
stgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepynvadvlq
llvietpivvnavttelclltvq

SCOPe Domain Coordinates for d2hj9d_:

Click to download the PDB-style file with coordinates for d2hj9d_.
(The format of our PDB-style files is described here.)

Timeline for d2hj9d_: