SCOPe 2.04: Domain d2hj9d_: 2hj9 D:

Lineage for d2hj9d_ (2hj9 D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.6: Sensory domain-like [103190] (3 families)
   alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain

5. Family d.110.6.3: LuxQ-periplasmic domain-like [160679] (1 protein)
   Pfam PF09308; two-domain arrangement similar to the YkuI C-terminal domain-like

6. Protein Autoinducer 2 sensor kinase/phosphatase LuxQ [160680] (3 species)

7. Species Vibrio harveyi [TaxId:669] [160681] (3 PDB entries)
   Uniprot P54302 51-271! Uniprot P54302 52-270

8. Domain d2hj9d_: 2hj9 D: [145396]
   Other proteins in same PDB: d2hj9a_, d2hj9b_
   automated match to d1zhhb1
   complexed with ai2

Details for d2hj9d_

PDB Entry: 2hj9, 2.34 Å

PDB Description: Crystal structure of the Autoinducer-2-bound form of Vibrio harveyi LuxP complexed with the periplasmic domain of LuxQ

PDB Compounds: (D:) Autoinducer 2 sensor kinase/phosphatase luxQ

SCOPe Domain Sequences for d2hj9d_:

Sequence, based on SEQRES records:

>d2hj9d_ d.110.6.3 (D:) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
alihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpshtpefrfl
tdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrrvpildp
stgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepynvadvlq
rkssdkrldkllvietpivvnavttelclltvq

Sequence, based on observed residues (ATOM records):

>d2hj9d_ d.110.6.3 (D:) Autoinducer 2 sensor kinase/phosphatase LuxQ {Vibrio harveyi [TaxId: 669]}
alihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpshtpefrfl
tdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrrvpildp
stgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepynvadvlq
llvietpivvnavttelclltvq

Timeline for d2hj9d_:

• d2hj9d_ first appeared in SCOP 1.75, called d2hj9d1
  
• d2hj9d_ appears in SCOPe 2.03
  
• d2hj9d_ appears in SCOPe 2.05
  
• d2hj9d_ appears in the current release, SCOPe 2.08