SCOPe 2.07: Domain d2hi7b1: 2hi7 B:14-162

Lineage for d2hi7b1 (2hi7 B:14-162)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.15: DsbB-like [158442] (1 family)
   contains an extra helix in a long loop between helices 3 and 4
   automatically mapped to Pfam PF02600

5. Family a.29.15.1: DsbB-like [158443] (1 protein)
   Pfam PF02600

6. Protein Disulfide bond formation protein DsbB [158444] (1 species)

7. Species Escherichia coli [TaxId:562] [158445] (1 PDB entry)
   Uniprot P0A6M2 14-162

8. Domain d2hi7b1: 2hi7 B:14-162 [145393]
   Other proteins in same PDB: d2hi7a1
   complexed with uq1, zn

Details for d2hi7b1

PDB Entry: 2hi7, 3.7 Å

PDB Description: crystal structure of dsba-dsbb-ubiquinone complex

PDB Compounds: (B:) Disulfide bond formation protein B

SCOPe Domain Sequences for d2hi7b1:

Sequence, based on SEQRES records:

>d2hi7b1 a.29.15.1 (B:14-162) Disulfide bond formation protein DsbB {Escherichia coli [TaxId: 562]}
awllmaftalaleltalwfqhvmllkpcvlciyervalfgvlgaaligaiapktplryva
mviwlysafrgvqltyehtmlqlypspfatcdfmvrfpewlpldkwvpqvfvasgdsaer
qwdflglempqwllgifiaylivavlvvi

Sequence, based on observed residues (ATOM records):

>d2hi7b1 a.29.15.1 (B:14-162) Disulfide bond formation protein DsbB {Escherichia coli [TaxId: 562]}
awllmaftalaleltalwfqhvmllkpcvlciyervalfgvlgaaligaiapktplryva
mviwlysafrgvqltyehtmlqlypspfatcdfmvrfpewlpldkwvpqvfvampqwllg
ifiaylivavlvvi

Timeline for d2hi7b1:

• d2hi7b1 first appeared in SCOP 1.75
  
• d2hi7b1 appears in SCOPe 2.06
  
• d2hi7b1 appears in the current release, SCOPe 2.08