Lineage for d2hi7b1 (2hi7 B:14-162)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767485Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 767786Superfamily a.29.15: DsbB-like [158442] (1 family) (S)
    contains an extra helix in a long loop between helices 3 and 4
  5. 767787Family a.29.15.1: DsbB-like [158443] (1 protein)
    Pfam PF02600
  6. 767788Protein Disulfide bond formation protein DsbB [158444] (1 species)
  7. 767789Species Escherichia coli [TaxId:562] [158445] (1 PDB entry)
    Uniprot P0A6M2 14-162
  8. 767790Domain d2hi7b1: 2hi7 B:14-162 [145393]
    Other proteins in same PDB: d2hi7a1
    complexed with uq1, zn; mutant

Details for d2hi7b1

PDB Entry: 2hi7 (more details), 3.7 Å

PDB Description: crystal structure of dsba-dsbb-ubiquinone complex
PDB Compounds: (B:) Disulfide bond formation protein B

SCOP Domain Sequences for d2hi7b1:

Sequence, based on SEQRES records: (download)

>d2hi7b1 a.29.15.1 (B:14-162) Disulfide bond formation protein DsbB {Escherichia coli [TaxId: 562]}
awllmaftalaleltalwfqhvmllkpcvlciyervalfgvlgaaligaiapktplryva
mviwlysafrgvqltyehtmlqlypspfatcdfmvrfpewlpldkwvpqvfvasgdsaer
qwdflglempqwllgifiaylivavlvvi

Sequence, based on observed residues (ATOM records): (download)

>d2hi7b1 a.29.15.1 (B:14-162) Disulfide bond formation protein DsbB {Escherichia coli [TaxId: 562]}
awllmaftalaleltalwfqhvmllkpcvlciyervalfgvlgaaligaiapktplryva
mviwlysafrgvqltyehtmlqlypspfatcdfmvrfpewlpldkwvpqvfvampqwllg
ifiaylivavlvvi

SCOP Domain Coordinates for d2hi7b1:

Click to download the PDB-style file with coordinates for d2hi7b1.
(The format of our PDB-style files is described here.)

Timeline for d2hi7b1: