| Class b: All beta proteins [48724] (176 folds) |
| Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) ![]() |
| Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
| Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species) contains additional all-beta (sub)domain in the C-terminal extension |
| Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries) |
| Domain d2hguy1: 2hgu Y:3-179 [145391] Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1 protein/RNA complex protein/RNA complex |
PDB Entry: 2hgu (more details), 4.51 Å
SCOPe Domain Sequences for d2hguy1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hguy1 b.53.1.1 (Y:3-179) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]}
yrlkayyregekpsalrragklpgvmynrhlnrkvyvdlvefdkvfrqasihhvivlelp
dgqslptlvrqvnldkrrrrpehvdffvlsdepvemyvplrfvgtpagvraggvlqeihr
dilvkvsprnipefievdvsgleigdslhasdlklppgvelavspeetiaavvpped
Timeline for d2hguy1:
View in 3DDomains from other chains: (mouse over for more information) d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1 |