Lineage for d2hgux1 (2hgu X:2-102)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310711Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1310712Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 1310755Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 1310836Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries)
    Uniprot Q72I15 2-102
  8. 1310846Domain d2hgux1: 2hgu X:2-102 [145390]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hguy1
    automatically matched to 2J01 Y:2-102
    protein/RNA complex

Details for d2hgux1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (X:) 50S ribosomal protein L24

SCOPe Domain Sequences for d2hgux1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgux1 b.34.5.1 (X:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc

SCOPe Domain Coordinates for d2hgux1:

Click to download the PDB-style file with coordinates for d2hgux1.
(The format of our PDB-style files is described here.)

Timeline for d2hgux1: