Lineage for d2hguw1 (2hgu W:3-95)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891281Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1891282Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1891283Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 1891284Protein Ribosomal protein L23 [54191] (4 species)
  7. 1891382Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries)
  8. 1891388Domain d2hguw1: 2hgu W:3-95 [145389]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hguw1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (W:) 50S ribosomal protein L23

SCOPe Domain Sequences for d2hguw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hguw1 d.12.1.1 (W:3-95) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]}
taydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvrgk
kkrlgrylgkrpdrkkaivqvapgqkiealegl

SCOPe Domain Coordinates for d2hguw1:

Click to download the PDB-style file with coordinates for d2hguw1.
(The format of our PDB-style files is described here.)

Timeline for d2hguw1: