Lineage for d2hguv1 (2hgu V:2-110)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192326Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2192327Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2192328Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2192329Protein Ribosomal protein L22 [54845] (5 species)
  7. 2192430Species Thermus thermophilus [TaxId:274] [160267] (10 PDB entries)
  8. 2192435Domain d2hguv1: 2hgu V:2-110 [145388]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hguv1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (V:) 50S ribosomal protein L22

SCOPe Domain Sequences for d2hguv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hguv1 d.55.1.1 (V:2-110) Ribosomal protein L22 {Thermus thermophilus [TaxId: 274]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

SCOPe Domain Coordinates for d2hguv1:

Click to download the PDB-style file with coordinates for d2hguv1.
(The format of our PDB-style files is described here.)

Timeline for d2hguv1: