Class b: All beta proteins [48724] (174 folds) |
Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) |
Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
Protein Ribosomal protein L21p [141093] (3 species) |
Species Thermus thermophilus [TaxId:274] [158939] (11 PDB entries) Uniprot P60492 1-101 |
Domain d2hguu1: 2hgu U:1-101 [145387] Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguv1, d2hguw1, d2hgux1, d2hguy1 automatically matched to 2HGJ U:1-101 |
PDB Entry: 2hgu (more details), 4.51 Å
SCOP Domain Sequences for d2hguu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hguu1 b.155.1.1 (U:1-101) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]} mfaivktggkqyrvepglklrvekldaepgatvelpvlllggektvvgtpvvegasvvae vlghgrgkkilvskfkakvqyrrkkghrqpytellikeirg
Timeline for d2hguu1:
View in 3D Domains from other chains: (mouse over for more information) d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguv1, d2hguw1, d2hgux1, d2hguy1 |