![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.144: PABP domain-like [63569] (2 superfamilies) 4 helices; an orthogonal array |
![]() | Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) ![]() |
![]() | Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein) |
![]() | Protein Ribosomal protein L20 [74733] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [158510] (11 PDB entries) Uniprot P60491 1-117 |
![]() | Domain d2hgut1: 2hgu T:2-118 [145386] Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1 automatically matched to 2J01 U:2-118 protein/RNA complex |
PDB Entry: 2hgu (more details), 4.51 Å
SCOPe Domain Sequences for d2hgut1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgut1 a.144.2.1 (T:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]} praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg
Timeline for d2hgut1:
![]() Domains from other chains: (mouse over for more information) d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1 |