Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
Species Thermus thermophilus [TaxId:274] [75245] (7 PDB entries) |
Domain d2hgur1: 2hgu R:23-108 [145385] Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1 protein/RNA complex protein/RNA complex |
PDB Entry: 2hgu (more details), 4.51 Å
SCOPe Domain Sequences for d2hgur1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hgur1 c.55.4.1 (R:23-108) Ribosomal protein L18 (L18p) {Thermus thermophilus [TaxId: 274]} rlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvgralaekalalgi kqvafdrgpykyhgrvkalaegareg
Timeline for d2hgur1:
View in 3D Domains from other chains: (mouse over for more information) d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1 |