Lineage for d2hgum1 (2hgu M:2-139)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114518Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2114519Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2114520Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2114521Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2114602Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries)
    Uniprot P60488 1-139
  8. 2114611Domain d2hgum1: 2hgu M:2-139 [145380]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hgum1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (M:) 50S ribosomal protein L13

SCOPe Domain Sequences for d2hgum1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgum1 c.21.1.1 (M:2-139) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
ktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadkir
vtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrlk
vyagpdhphqaqrpekle

SCOPe Domain Coordinates for d2hgum1:

Click to download the PDB-style file with coordinates for d2hgum1.
(The format of our PDB-style files is described here.)

Timeline for d2hgum1: