Lineage for d2hguk1 (2hgu K:56-148)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920269Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
    alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta
  4. 1920270Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family) (S)
    automatically mapped to Pfam PF03948
  5. 1920271Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)
  6. 1920272Protein Ribosomal protein L9 C-domain [55655] (3 species)
  7. 1920305Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries)
    Uniprot Q5SLQ1 55-146
  8. 1920310Domain d2hguk1: 2hgu K:56-148 [145376]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hguk1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (K:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2hguk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hguk1 d.99.1.1 (K:56-148) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
krlaerkaeaerlkkilenltltipvragetkiygsvtakdiaealsrqhgvtidpkrla
lekpikelgeyvltykphpevpiqlkvsvvaqe

SCOPe Domain Coordinates for d2hguk1:

Click to download the PDB-style file with coordinates for d2hguk1.
(The format of our PDB-style files is described here.)

Timeline for d2hguk1: