Lineage for d2hgug1 (2hgu G:3-182)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200932Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2200933Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2200934Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 2200935Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 2201017Species Thermus thermophilus [TaxId:274] [82718] (6 PDB entries)
  8. 2201024Domain d2hgug1: 2hgu G:3-182 [145373]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    protein/RNA complex
    protein/RNA complex

Details for d2hgug1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (G:) 50S ribosomal protein L5

SCOPe Domain Sequences for d2hgug1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgug1 d.77.1.1 (G:3-182) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]}
ldvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelal
itgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnp
nsfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk

SCOPe Domain Coordinates for d2hgug1:

Click to download the PDB-style file with coordinates for d2hgug1.
(The format of our PDB-style files is described here.)

Timeline for d2hgug1: