Lineage for d2hgud2 (2hgu D:5-126)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 799829Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
    incomplete OB-fold lacking the last strand
  7. 799909Species Thermus thermophilus [TaxId:274] [159084] (5 PDB entries)
    Uniprot Q72I07 1-125
  8. 799914Domain d2hgud2: 2hgu D:5-126 [145370]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hguc1, d2hgud1, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    automatically matched to 2J01 D:2-126

Details for d2hgud2

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (D:) 50S ribosomal protein L2

SCOP Domain Sequences for d2hgud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgud2 b.40.4.5 (D:5-126) N-terminal domain of ribosomal protein L2 {Thermus thermophilus [TaxId: 274]}
kfkpytpsrrfmtvadfseitktepekslvkplkktggrnnqgritvrfrggghkrlyri
idfkrwdkvgipakvaaieydpnrsariallhyvdgekryiiapdglqvgqqvvagpdap
iq

SCOP Domain Coordinates for d2hgud2:

Click to download the PDB-style file with coordinates for d2hgud2.
(The format of our PDB-style files is described here.)

Timeline for d2hgud2: