Lineage for d2hguc1 (2hgu C:5-228)

  1. Root: SCOPe 2.01
  2. 1054197Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1057199Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 1057200Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
  5. 1057201Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 1057202Protein Ribosomal protein L1 [56810] (4 species)
  7. 1057213Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 1057227Domain d2hguc1: 2hgu C:5-228 [145368]
    Other proteins in same PDB: d2hgu11, d2hgu21, d2hgu31, d2hgu41, d2hgu51, d2hgu61, d2hgu71, d2hgu81, d2hgud1, d2hgud2, d2hgue1, d2hguf1, d2hgug1, d2hguh1, d2hguh2, d2hguk1, d2hguk2, d2hgul1, d2hgul2, d2hgum1, d2hgun1, d2hguo1, d2hgup1, d2hguq1, d2hgur1, d2hgut1, d2hguu1, d2hguv1, d2hguw1, d2hgux1, d2hguy1
    automatically matched to 1YL3 C:5-228
    protein/RNA complex

Details for d2hguc1

PDB Entry: 2hgu (more details), 4.51 Å

PDB Description: 70S T.Th. ribosome functional complex with mRNA and E- and P-site tRNAs at 4.5A. This entry 2HGU contains 50S ribosomal subunit. The 30S ribosomal subunit can be found in PDB entry 2HGR.
PDB Compounds: (C:) 50s ribosomal protein l1

SCOPe Domain Sequences for d2hguc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hguc1 e.24.1.1 (C:5-228) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl
phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg
sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek
ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

SCOPe Domain Coordinates for d2hguc1:

Click to download the PDB-style file with coordinates for d2hguc1.
(The format of our PDB-style files is described here.)

Timeline for d2hguc1: